PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_10933-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 121aa    MW: 13769.7 Da    PI: 8.6452
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_10933-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.85.2e-13242848
                     HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     Ed++lv +++ +G g W + +++ g++R++k+c++rw++yl
  TRIUR3_10933-P1  2 EDDILVSYINDHGEGKWGSLPKRAGLNRCGKSCRLRWLNYL 42
                     9***************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.568146IPR017930Myb domain
SMARTSM007173.6E-4144IPR001005SANT/Myb domain
CDDcd001675.24E-8242No hitNo description
Gene3DG3DSA:1.10.10.606.8E-16245IPR009057Homeodomain-like
PfamPF002493.0E-11242IPR001005SANT/Myb domain
SuperFamilySSF466896.84E-17269IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-64669IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MEDDILVSYI NDHGEGKWGS LPKRAGLNRC GKSCRLRWLN YLRPGIKRGN ISDDEEELIV  60
RLHGLLGNRS RTKCHSLPDL AQQPLLIDLH HDLEKALTYN NHALCQTVTY AEAAANLVRR  120
K
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5997217e-82AB599721.1 Triticum aestivum Tamyb10-A1 gene for myb-related protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561552.13e-39PREDICTED: transcription repressor MYB6-like
RefseqXP_002465146.14e-39hypothetical protein SORBIDRAFT_01g032770
SwissprotQ9FJA23e-33TT2_ARATH; Transcription factor TT2
TrEMBLM7ZT912e-85M7ZT91_TRIUA; Transcription factor TT2
STRINGMLOC_21581.19e-42(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.12e-34MYB family protein